PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 241aa    MW: 28017.4 Da    PI: 7.9647
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00595genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd ll d+++ +G g+W++ +++ g++R++k+c++rw +yl
       AA61G00595 14 RGRWTAEEDRLLSDYIHSYGDGSWRSLPKKAGLKRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding57.82.6e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+el+v+++  +G++ W++Ia++++ gRt++++k++w+++l
       AA61G00595  67 RGNITQEEEELIVKLHSSYGNR-WSLIASKLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.666961IPR017930Myb domain
SuperFamilySSF466899.17E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-221568IPR009057Homeodomain-like
CDDcd001672.50E-91661No hitNo description
PROSITE profilePS5129427.25762116IPR017930Myb domain
SMARTSM007176.9E-1866114IPR001005SANT/Myb domain
PfamPF002495.2E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2669116IPR009057Homeodomain-like
CDDcd001675.92E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRAPCCEKV GMKRGRWTAE EDRLLSDYIH SYGDGSWRSL PKKAGLKRCG KSCRLRWINY  60
LREDVKRGNI TQEEEELIVK LHSSYGNRWS LIASKLPGRT DNEIKNYWNS HLSRKLHYFM  120
RKSTVKKSFI SPPLPKSKST QETKNGAVSV SIPAEKKAYE DSEPARGSID QNENDLFVDR  180
NFDRRDSQNL WHGNEALDDL FVDRNVDTRE SQNLRDGNER LDDLVLSWLL EGEEDLLDLW  240
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402364.12e-78hypothetical protein EUTSA_v10006080mg
SwissprotO222642e-74MYB12_ARATH; Transcription factor MYB12
TrEMBLV4LMW42e-78V4LMW4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__2983__AT2G47460.14e-72(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-75myb domain protein 12